CD274, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5126-0.1MG CD274, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

Human CD274 (programmed cell death 1 ligand 1) is a cell membrane protein which is involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Recent data indicated that cancer cells that express PDL1 promote tumor progression through inhibition of PD1-expressing immune effectors. In addition, PDL1 modulates cell-mediated immunity in the infectious disease setting.

Recombinant human CD274 extracellular domain cDNA (19-238 aa, derived from BC074984) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method

CD274, Human, Recombinant
Catalog # 5126

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90% as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

 Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_054862.1

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQG^GEFFTVTVPKDLYV
VEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEE
DLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRC
MISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQA
EGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRIN
TTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

 

 


 

 

References Downloads