CD164, Human, Recombinant,  0.05 mg [BM-5100-0.05MG] - $214.50 Equl offers Enzyme Assay Kits, Reagent Mixtures, Enzymes, Glycobiology, Amylase Test, Carbohydrase Tablet Tests, Protease Tablet Tests, Cofactors and Stains, Soluble Chromogenic Substrates, Insoluble Chromogenic Substrates, etc 

CD164, Human, Recombinant,  0.05 mg

Price(USD):$214.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5100-0.05MG CD164, Human, Recombinant,  0.05 mg EA 0.05 mg Gel Ice $214.50  
Introduction:

CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functions in vitro.

Full-length of human CD164 extracellular domain cDNA (24 – 162 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

Parameter, Testing, and Method

CD164, Human, Recombinant
Catalog # 5100

Quantity

0.05 mg (50 µg/vial)

Volume

0.1 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl,
KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

-20 °C

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Gene Symbols

CD164 (endolyn, MUC-24)

Accession Number

NP_006007

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPI
SNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIE
CKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQ
PSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

 

 


 

 

References Downloads