CD164, Human, Recombinant,  0.05 mg

Price(USD):$214.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5100-0.05MG CD164, Human, Recombinant,  0.05 mg EA 0.05 mg Gel Ice $214.50  
Introduction:

CD164 (Sialomucins) belongs to a heterogeneous group of secreted or membrane-associated mucins that appear to play two key but opposing roles in vivo: 1) as cytoprotective or anti-adhesive agents and 2) as adhesion receptors. CD164 is a type I integral transmembrane sialomucin that functions as an adhesion receptor. Recombinant CD164 protein may serve as coating matrix protein for studying of hematopoietic stem cell (HSC) functions in vitro.

Full-length of human CD164 extracellular domain cDNA (24 – 162 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.

Parameter, Testing, and Method

CD164, Human, Recombinant
Catalog # 5100

Quantity

0.05 mg (50 µg/vial)

Volume

0.1 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl,
KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

-20 °C

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Gene Symbols

CD164 (endolyn, MUC-24)

Accession Number

NP_006007

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPI
SNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIE
CKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQ
PSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD

 

 


 

 

References Downloads