ICAM2, Human, Recombinant, 0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5107-0.1MG ICAM2, Human, Recombinant, 0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

The protein encoded by human ICAM2 gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. Several transcript variants encoding the same protein have been found for this gene.

Full-length extracellular domain of human ICAM2 gene (25-223 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

                                                                                                                                                            

Parameter, Testing, and Method

ICAM2, Human, Recombinant
Catalog # 5107

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl,  KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

-20 °C

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Gene Symbols

ICAM2 ( CD102 )

Accession Number

NP_000864

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFELKVFEVHVRPKKLAVEPKGSLEV
NCSTTCNQPEVGGLETSLDKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQ
ESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNET
LHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSA
PKMLEIYEPVSDSQ

 

 


 

 

References Downloads