CD276, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5123-0.1MG CD276, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

The protein encoded by human CD276 gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3′ UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29.

Full-length extracellular domain of human CD276 gene (29 – 466 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method

CD276, Human, Recombinant
Catalog # 5123

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl,
KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

-20 °C

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Gene Symbols

CD276 (4Ig-B7-H3; B7-H3; B7H3)

Accession Number

NP_001019907

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGEVQVPEDPVVALVGTDATLCCSFSPEP
GFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQR
VRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCS
SYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYS
CLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEP
GFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQR
VRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCS
SYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYS
CLVRNPVLQQDAHGSVTITGQPMTFPPEA

 

 


 

 

References Downloads