CD270, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5127-0.1MG CD270, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

The protein encoded by human tumor necrosis factor receptor superfamily member 14 ( TNFRSF14, CD270) gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response.

Recombinant human CD270 extracellular domain cDNA ( 39 – 202 aa) was constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified

Parameter, Testing, and Method

CD270, Human, Recombinant
Catalog # 5127

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_003811.2

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQG^GEFLPSCKEDEYP
VGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNG
LSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIV
QDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPG
TFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV

 

 


References Downloads