CD86, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5096-0.1MG CD86, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

Human CD86 gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms. Recombinant CD86 may service as coating matrix protein for studying of  T cell functions in vitro.

Full-length human CD86 extracellular domain cDNA (24 – 247 aa, Isoform-2) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein

Parameter, Testing, and Method

CD86, Human, Recombinant
Catalog # 5096

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_008820

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFELPLKIQAY
FNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYL
GKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLY
QCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITE
NVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKS
QDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLS
SPFSIELEDPQPPPDHIP

References Downloads