CDH18, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5090-0.1MG CDH18, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:
Human CDH18 gene encodes a type II classical cadherin from the cadherin superfamily of integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. Human CDH18 is expressed specifically in the central nervous system and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Full-length extracellular domain of human CDH18 gene (54-608 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method

CDH18, Human, Recombinant
Catalog # 5090

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90% as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_004925

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFGWVWNQFFVLE
EHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDT
TGDIHSTKSLDREQKTHYVLHAQAIDRRTNKPLEPESEFIIKVQ
DINDNAPKFTDGPYIVTVPEMSDMGTSVLQVTATDADDPTYG
NSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSV
VIQAKDMAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLY
VPESAQVGSAVGKIKANDADTGSNADMTYSIINGDGMGIFS
ISTDKETREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSHLG
PFKDATMLKIIVGDVDEPPLFSMPSYLMEVYENAKIGTVVGTVL
AQDPDSTNSLVRYFINYNVEDDRFFNIDANTGTIRTTKVLDRE
ETPWYNITVTASEIDNPDLLSHVTVGIRVLDVNDNPPELAREYD
IIVCENSKPGQVIHTISATDKDDFANGPRFNFFLDERLPVNPNF
TLKDNEDNTASILTRRRRFSRTVQDVYYLPIMISDGGIPSLSSS
STLTIRVCACERDGRVRTCHAEAFLSS

 

 


 

 

References Downloads