CD14, Human, Recombinant,  0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5089-0.1MG CD14, Human, Recombinant,  0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes / macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.

Full-length extracellular domain of human CD14 gene (20-345 aa) was constructed with 29 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

 

 

Parameter, Testing, and Method

CD14, Human, Recombinant

Catalog # 5089

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90% as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

 Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_000582

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRC
VCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADA
DPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKEL
TLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQ
WLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERG
LMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDL
SHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN

 

 


 

 

References Downloads