Human, Recombinant, 0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5125-0.1MG Human, Recombinant, 0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:

CDH13 gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of other cadherins, and so is not thought to be a cell-cell adhesion glycoprotein. This protein acts as a negative regulator of axon growth during neural differentiation. It also protects vascular endothelial cells from apoptosis due to oxidative stress, and is associated with resistance to atherosclerosis. The gene is hypermethylated in many types of cancer.

Full-length extracellular domain of human CDH13 gene (139-693 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method

CDH13, Human, Recombinant

Catalog # 5125

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90% as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_001248

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQ
RQPFPRDVGKVVDSDRPERSKFRLTGKGVDQEPKGIFRINENTG
SVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQN
DNRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLR
YNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKY
ELIIEAQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQAT
VEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHT
NPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPS
STATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATD
PDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVD
NSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAE
VCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKIS
KINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQV
CSCRNSKVDCNAAG

 

 


 

 

References Downloads