Human, Recombinant, 0.1 mg

Price(USD):$266.50

       *Ask Promo Code:    
Equl SKU Product Name UOM Specification Shipping Temperature Price(USD) Add to Cart:
BM-5086-0.1MG Human, Recombinant, 0.1 mg EA 0.1 mg Gel Ice $266.50  
Introduction:
CD2 is a surface antigen of the human T-lymphocyte lineage that is expressed on all peripheral blood T cells. It is one of the earliest T-cell markers, being present on more than 95% of thymocytes; it is also found on some natural killer cells but not on B lymphocytes. Monoclonal antibodies directed against CD2 inhibit the formation of rosettes with sheep erythrocytes, indicating that CD2 is the erythrocyte receptor or is closely associated with it. Recombinant CD2 protein could be serviced as coating matrix protein for study human T cells expansion in vitro.

Full-length extracellular domain of human CD2 gene (25 – 209 aa) was constructed with 31 N-terminal T7/His tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.

Parameter, Testing, and Method

CD2, Human, Recombinant
Catalog # 5086

Quantity

0.1 mg (100 µg/vial)

Volume

0.2 mL

Concentration

0.5 mg/mL

Purity

>90%
as measured by SDS PAGE

Formulation

Formulated in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol.

Form

Solution

Production Type

Recombinant – E. coli

Storage Temperature

-20 °C

Shelf Life

12 months after receipt

Sterilization Method

Filtration

Cell Attachment Activity

Passes

Sterility

No growth

Accession Number

NP_001758

Recombinant Protein Sequence

MASMTGGQQMGRGHHHHHHGNLYFQGGEFEL
KEITNALETWGALGQDINLDIPSFQMSDDID
DIKWEKTSDKKKIAQFRKEKETFKEKDTYKL
FKNGTLKIKHLKTDDQDIYKVSIYDTKGKNV
LEKIFDLKIQERVSKPKISWCINTTLTCEVM
NGTDPELNLYQDGKHLKLSQRVITHKWTTSL
SAKFKCTAGNKVSKESSVEPVSCPEKGLD

 

 


 

 

References Downloads